PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g005380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 700aa    MW: 77996 Da    PI: 5.3738
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g005380.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.3e-182579256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    r+ +++t++q++ Le++F ++++p +++r++L ++l+L  +qVk+WFqN+R++ k
  Csa19g005380.1 25 RTGHRHTPQQIQGLEAFFMECPHPEEAQRQQLCEELKLGLDQVKFWFQNKRTQCK 79
                    555789*********************************************9987 PP

2START116.53.7e-372164354206
                     HHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
           START   4 eeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                      +a +el ++   ee++Wvkss       +sen++     +++ ++   ++e ++ ++vv+ ++++l e +ld+  +W+e ++    ka+tl v+
  Csa19g005380.1 216 ASAVEELKRLFFTEEQFWVKSSidgtdviDSENYENFSNAVKKFRStsAHVESSKGVTVVPIEATNLIEMFLDSE-KWKELFPtmviKAKTLHVL 309
                     66778888888899**********9999977777765544433222556**************************.99999999999******** PP

                     CTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
           START  86 ssg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                      s        ++l +m  +l  lsplvp R+f++vR++++ ++g w+i+dvS ++  +   ++s+    ++pSg+li++++n  skv w+ehv++
  Csa19g005380.1 310 GSElpirencNILRVMWEQLHILSPLVPpREFMIVRCCQEISKGLWIIADVSHNVYFDFV-NASC---YKRPSGCLIQSLPNAQSKVMWIEHVEV 400
                     ****************************************************99998887.4555...559************************ PP

                     -SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 173 kgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     + +l  h ++r l++ g   gak+w atl+r ce+
  Csa19g005380.1 401 GQKLDtHKIYRELLSGGSGYGAKRWIATLERMCER 435
                     ****99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-18579IPR009057Homeodomain-like
SuperFamilySSF466899.61E-17981IPR009057Homeodomain-like
PROSITE profilePS5007115.0782181IPR001356Homeobox domain
SMARTSM003891.1E-162385IPR001356Homeobox domain
CDDcd000864.62E-162482No hitNo description
PfamPF000461.6E-152679IPR001356Homeobox domain
PROSITE profilePS5084840.212204438IPR002913START domain
SuperFamilySSF559619.06E-27205436No hitNo description
CDDcd088751.58E-83209434No hitNo description
SMARTSM002347.4E-18213435IPR002913START domain
PfamPF018526.9E-31216435IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-7217401IPR023393START-like domain
SuperFamilySSF559614.53E-7456663No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MENDGSGSSC NEQYASEDSK QSGKRTGHRH TPQQIQGLEA FFMECPHPEE AQRQQLCEEL  60
KLGLDQVKFW FQNKRTQCKV QEEKANNLAL RGENEILKSE NEAMVEALSS VNCPDCGGPP  120
FGREERALNF QKLLLENARL KEQRDKIYHL VSNISKRPTV GGSLASVPTQ HIFDHISSYG  180
INPSHMFDAS SSFGPPTSQP TQPQPMDVSL LSETAASAVE ELKRLFFTEE QFWVKSSIDG  240
TDVIDSENYE NFSNAVKKFR STSAHVESSK GVTVVPIEAT NLIEMFLDSE KWKELFPTMV  300
IKAKTLHVLG SELPIRENCN ILRVMWEQLH ILSPLVPPRE FMIVRCCQEI SKGLWIIADV  360
SHNVYFDFVN ASCYKRPSGC LIQSLPNAQS KVMWIEHVEV GQKLDTHKIY RELLSGGSGY  420
GAKRWIATLE RMCERMALTS NLTLPASDWS EVIRTGEERR RVLKLGERMI MNFNEMLTMS  480
GKVDLPQQSK CGVRVSMRMN LEAGQPPGLI VSAASSLAIS LPPVQVFDLL RKLDTREQWD  540
VLAYGTVVTE IARIATGSSE TNCLSILRPT QEENNGKMMA QDSDKDDILM LQDCYMDALG  600
GMLVYAPMDM ATMDTTLSGA DVKISDIPIL PSGFIISSDG RRSTVEDGGT LLTLAFQILV  660
SGNTNRAREV NEKSVNTVST LISSTVQRIK GLLNCPDQC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485661.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM127911530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.10.0homeodomain GLABROUS 8